PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_16779
Common NameKK1_017274
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family TALE
Protein Properties Length: 368aa    MW: 41410.3 Da    PI: 6.6226
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_16779genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-092943301955
                    HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
       Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yps++++  LA+++gL+++q+ +WF N+R ++
  C.cajan_16779 294 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 330
                    45679*****************************885 PP

2ELK41.13.7e-14250271122
            ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                    ELK qLlrKYsgyLgsLkqEF+
  C.cajan_16779 250 ELKGQLLRKYSGYLGSLKQEFM 271
                    9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.1E-19114158IPR005540KNOX1
PfamPF037901.8E-22116154IPR005540KNOX1
SMARTSM012561.7E-26165216IPR005541KNOX2
PfamPF037916.8E-21168214IPR005541KNOX2
SMARTSM011882.8E-8250271IPR005539ELK domain
PfamPF037896.1E-11250271IPR005539ELK domain
PROSITE profilePS5121311.174250270IPR005539ELK domain
PROSITE profilePS5007113.086270333IPR001356Homeobox domain
SuperFamilySSF466891.67E-19272348IPR009057Homeodomain-like
SMARTSM003891.2E-12272337IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.8E-28275335IPR009057Homeodomain-like
CDDcd000861.19E-12282334No hitNo description
PfamPF059206.7E-17290329IPR008422Homeobox KN domain
PROSITE patternPS000270308331IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MEGSSSNGPS YLLAFGENSG GLCPMTMMPL VTSHHAAHHP INPNPSNNTN NNANTNCLFI  60
PNCTNSETHP SIMLDNNHNN TTDDNNTGLG YYFMESGHHH HHRNNNGSSS SSSSGVKAKI  120
MAHPHYHRLL AAYVNCQKVG APPEVVARLE EACASAVSMA GDAAGSGCIG EDPALDQFME  180
AYCEMLTKYE QELSKPLKEA MLFLQRIECQ FKNLAISSSD YACNEGGDRN GSSEEDVDLH  240
NIDPQAEDRE LKGQLLRKYS GYLGSLKQEF MKKRKKGKLP KEARQQLLEW WSRHYKWPYP  300
SESQKLALAE STGLDQKQIN NWFINQRKRH WKPSEDMQFV VMDPSHPHYY MDNVLNNPFP  360
MDLSHHML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1265274LKQEFMKKRK
2271275KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankSOYHOMEOGE0.0L13663.1 Glycine max homeobox-containing (Sbh1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014518713.10.0PREDICTED: homeobox protein SBH1-like isoform X1
RefseqXP_014518714.10.0PREDICTED: homeobox protein SBH1-like isoform X1
RefseqXP_014518715.10.0PREDICTED: homeobox protein SBH1-like isoform X1
SwissprotP466080.0HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A151T6Q40.0A0A151T6Q4_CAJCA; Homeobox protein SBH1
STRINGGLYMA15G11850.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-135KNOX/ELK homeobox transcription factor